Recombinant Human COQ5 Protein, GST-tagged
Cat.No. : | COQ5-1718H |
Product Overview : | Human COQ5 full-length ORF (BAB71567.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDINKEMLKVGKQKALAQGHDRRCRLSQGDLRKSNIRHCGHSFWLQTLIPFLSWSMNQSYPVESLELKDNLANETAAEHLLLRIRALDSCLNRTVSKWKNKFLSLFYSFLWSCFSPSPRGIWSVSLLNC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COQ5 coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | COQ5 |
Synonyms | COQ5; coenzyme Q5 homolog, methyltransferase (S. cerevisiae); coenzyme Q5 homolog, methyltransferase (yeast); 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; 2 methoxy 6 polyprenyl 1; 4 benzoquinol methylase; MGC4767; ubiquinone biosynthesis methyltransferase COQ5, mitochondrial; MGC104303; |
Gene ID | 84274 |
mRNA Refseq | NM_032314 |
Protein Refseq | NP_115690 |
MIM | 616359 |
UniProt ID | Q5HYK3 |
◆ Recombinant Proteins | ||
COQ5-1343C | Recombinant Chicken COQ5 | +Inquiry |
COQ5-11471H | Recombinant Human COQ5, His-tagged | +Inquiry |
COQ5-1976HF | Recombinant Full Length Human COQ5 Protein, GST-tagged | +Inquiry |
COQ5-3792M | Recombinant Mouse COQ5 Protein | +Inquiry |
COQ5-1265Z | Recombinant Zebrafish COQ5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ5-7347HCL | Recombinant Human COQ5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COQ5 Products
Required fields are marked with *
My Review for All COQ5 Products
Required fields are marked with *