Recombinant Human COQ5 Protein, GST-tagged

Cat.No. : COQ5-1718H
Product Overview : Human COQ5 full-length ORF (BAB71567.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity.
Molecular Mass : 54.3 kDa
AA Sequence : MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDINKEMLKVGKQKALAQGHDRRCRLSQGDLRKSNIRHCGHSFWLQTLIPFLSWSMNQSYPVESLELKDNLANETAAEHLLLRIRALDSCLNRTVSKWKNKFLSLFYSFLWSCFSPSPRGIWSVSLLNC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COQ5 coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [ Homo sapiens ]
Official Symbol COQ5
Synonyms COQ5; coenzyme Q5 homolog, methyltransferase (S. cerevisiae); coenzyme Q5 homolog, methyltransferase (yeast); 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; 2 methoxy 6 polyprenyl 1; 4 benzoquinol methylase; MGC4767; ubiquinone biosynthesis methyltransferase COQ5, mitochondrial; MGC104303;
Gene ID 84274
mRNA Refseq NM_032314
Protein Refseq NP_115690
MIM 616359
UniProt ID Q5HYK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COQ5 Products

Required fields are marked with *

My Review for All COQ5 Products

Required fields are marked with *

0
cart-icon
0
compare icon