Recombinant Human COQ9 Protein, GST-tagged
Cat.No. : | COQ9-1721H |
Product Overview : | Human COQ9 full-length ORF (AAH64946.1, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010] |
Molecular Mass : | 61.38 kDa |
AA Sequence : | MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | COQ9 |
Synonyms | COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49 , coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046; |
Gene ID | 57017 |
mRNA Refseq | NM_020312 |
Protein Refseq | NP_064708 |
MIM | 612837 |
UniProt ID | O75208 |
◆ Recombinant Proteins | ||
COQ9-1901M | Recombinant Mouse COQ9 Protein, His (Fc)-Avi-tagged | +Inquiry |
COQ9-5707Z | Recombinant Zebrafish COQ9 | +Inquiry |
COQ9-3795M | Recombinant Mouse COQ9 Protein | +Inquiry |
COQ9-1979HF | Recombinant Full Length Human COQ9 Protein, GST-tagged | +Inquiry |
COQ9-1721H | Recombinant Human COQ9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ9-7346HCL | Recombinant Human COQ9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COQ9 Products
Required fields are marked with *
My Review for All COQ9 Products
Required fields are marked with *
0
Inquiry Basket