Recombinant Human CORIN protein(1-110aa), His-tagged
Cat.No. : | CORIN-3928H |
Product Overview : | Recombinant Human CORIN protein(Q9Y5Q5)(1-110aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
Gene Name | CORIN corin, serine peptidase [ Homo sapiens ] |
Official Symbol | CORIN |
Synonyms | CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742; |
Gene ID | 10699 |
mRNA Refseq | NM_006587 |
Protein Refseq | NP_006578 |
MIM | 605236 |
UniProt ID | Q9Y5Q5 |
◆ Recombinant Proteins | ||
Corin-444R | Recombinant Rat Corin Protein, His-tagged | +Inquiry |
CORIN-3796M | Recombinant Mouse CORIN Protein | +Inquiry |
CORIN-644H | Recombinant Human CORIN Protein, His (Fc)-Avi-tagged | +Inquiry |
CORIN-274HFL | Active Recombinant Full Length Human CORIN Protein, C-Flag-tagged | +Inquiry |
Corin-442M | Recombinant Mouse Corin Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORIN Products
Required fields are marked with *
My Review for All CORIN Products
Required fields are marked with *
0
Inquiry Basket