Recombinant Human CORIN protein(1-110aa), His-tagged
| Cat.No. : | CORIN-3928H |
| Product Overview : | Recombinant Human CORIN protein(Q9Y5Q5)(1-110aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-110aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
| Gene Name | CORIN corin, serine peptidase [ Homo sapiens ] |
| Official Symbol | CORIN |
| Synonyms | CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742; |
| Gene ID | 10699 |
| mRNA Refseq | NM_006587 |
| Protein Refseq | NP_006578 |
| MIM | 605236 |
| UniProt ID | Q9Y5Q5 |
| ◆ Recombinant Proteins | ||
| Corin-444R | Recombinant Rat Corin Protein, His-tagged | +Inquiry |
| Corin-442M | Recombinant Mouse Corin Protein, His-tagged | +Inquiry |
| Corin-2271M | Recombinant Mouse Corin Protein, Myc/DDK-tagged | +Inquiry |
| CORIN-1544R | Recombinant Rat CORIN Protein | +Inquiry |
| CORIN-439H | Recombinant Human CORIN Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORIN Products
Required fields are marked with *
My Review for All CORIN Products
Required fields are marked with *
