Recombinant Human COTL1 protein, His-SUMO-tagged
Cat.No. : | COTL1-4425H |
Product Overview : | Recombinant Human COTL1 protein(Q14019)(2-142aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-142aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | COTL1 coactosin-like 1 (Dictyostelium) [ Homo sapiens ] |
Official Symbol | COTL1 |
Synonyms | COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733; |
Gene ID | 23406 |
mRNA Refseq | NM_021149 |
Protein Refseq | NP_066972 |
MIM | 606748 |
UniProt ID | Q14019 |
◆ Recombinant Proteins | ||
COTL1-1730H | Recombinant Human COTL1 Protein, GST-tagged | +Inquiry |
COTL1-804R | Recombinant Rhesus Macaque COTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COTL1-10372Z | Recombinant Zebrafish COTL1 | +Inquiry |
COTL1-1206R | Recombinant Rat COTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COTL1-6705H | Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COTL1 Products
Required fields are marked with *
My Review for All COTL1 Products
Required fields are marked with *