Recombinant Human CPA2 protein, His-tagged
Cat.No. : | CPA2-3704H |
Product Overview : | Recombinant Human CPA2 protein(179-417 aa), fused to His tag, was expressed in E. coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 179-417 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CPA2 carboxypeptidase A2 (pancreatic) [ Homo sapiens ] |
Official Symbol | CPA2 |
Synonyms | CPA2; carboxypeptidase A2 (pancreatic); carboxypeptidase A2; |
Gene ID | 1358 |
mRNA Refseq | NM_001869 |
Protein Refseq | NP_001860 |
MIM | 600688 |
UniProt ID | P48052 |
◆ Recombinant Proteins | ||
CPA2-3304H | Recombinant Human CPA2 Protein, MYC/DDK-tagged | +Inquiry |
CPA2-3174H | Active Recombinant Human CPA2 protein, His-tagged | +Inquiry |
CPA2-1587H | Recombinant Human CPA2 Protein (Leu17-Tyr417), C-His tagged | +Inquiry |
Cpa2-1135R | Recombinant Rat Cpa2 Protein, His-tagged | +Inquiry |
CPA2-1770H | Recombinant Human CPA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPA2-1633MCL | Recombinant Mouse CPA2 cell lysate | +Inquiry |
CPA2-3030HCL | Recombinant Human CPA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPA2 Products
Required fields are marked with *
My Review for All CPA2 Products
Required fields are marked with *