Recombinant Human CPE Protein, GST-tagged
| Cat.No. : | CPE-1780H |
| Product Overview : | Human CPE partial ORF ( NP_001864.1, 211 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 38.39 kDa |
| AA Sequence : | LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CPE carboxypeptidase E [ Homo sapiens ] |
| Official Symbol | CPE |
| Synonyms | CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase; |
| Gene ID | 1363 |
| mRNA Refseq | NM_001873 |
| Protein Refseq | NP_001864 |
| MIM | 114855 |
| UniProt ID | P16870 |
| ◆ Recombinant Proteins | ||
| CPE-210H | Recombinant Human CPE, His-tagged | +Inquiry |
| CPE-224H | Recombinant Human CPE, C13&N15-labeled | +Inquiry |
| Cpe-931M | Recombinant Mouse Cpe Protein, MYC/DDK-tagged | +Inquiry |
| CPE-7253H | Recombinant Human CPE, His-tagged | +Inquiry |
| CPE-199H | Recombinant Human CPE, His-tagged, C13&N15 Labeled | +Inquiry |
| ◆ Native Proteins | ||
| cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPE Products
Required fields are marked with *
My Review for All CPE Products
Required fields are marked with *



