Recombinant Human CPE Protein, GST-tagged
Cat.No. : | CPE-1780H |
Product Overview : | Human CPE partial ORF ( NP_001864.1, 211 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 38.39 kDa |
AA Sequence : | LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CPE carboxypeptidase E [ Homo sapiens ] |
Official Symbol | CPE |
Synonyms | CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase; |
Gene ID | 1363 |
mRNA Refseq | NM_001873 |
Protein Refseq | NP_001864 |
MIM | 114855 |
UniProt ID | P16870 |
◆ Recombinant Proteins | ||
CPE-1780H | Recombinant Human CPE Protein, GST-tagged | +Inquiry |
CPE-12820Z | Recombinant Zebrafish CPE | +Inquiry |
CPE-2952H | Recombinant Human CPE protein, His-tagged | +Inquiry |
Cpe-784M | Recombinant Mouse Cpe Protein, His-tagged | +Inquiry |
CPE-2726H | Recombinant Human CPE Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPE Products
Required fields are marked with *
My Review for All CPE Products
Required fields are marked with *