Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CPLX4-364H |
Product Overview : | CPLX4 MS Standard C13 and N15-labeled recombinant protein (NP_857637) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009] |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CPLX4 complexin 4 [ Homo sapiens (human) ] |
Official Symbol | CPLX4 |
Synonyms | CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683; |
Gene ID | 339302 |
mRNA Refseq | NM_181654 |
Protein Refseq | NP_857637 |
MIM | 609586 |
UniProt ID | Q7Z7G2 |
◆ Recombinant Proteins | ||
CPLX4-11522H | Recombinant Human CPLX4, GST-tagged | +Inquiry |
CPLX4-3842M | Recombinant Mouse CPLX4 Protein | +Inquiry |
Cplx4-2288M | Recombinant Mouse Cplx4 Protein, Myc/DDK-tagged | +Inquiry |
CPLX4-2077HF | Recombinant Full Length Human CPLX4 Protein, GST-tagged | +Inquiry |
CPLX4-1788H | Recombinant Human CPLX4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPLX4-7311HCL | Recombinant Human CPLX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPLX4 Products
Required fields are marked with *
My Review for All CPLX4 Products
Required fields are marked with *