Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CPLX4-364H
• Product Overview: CPLX4 MS Standard C13 and N15-labeled recombinant protein (NP_857637) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009]
• Molecular Mass: 18.3 kDa
• AA Sequence: MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CPLX4 complexin 4 [ Homo sapiens (human) ]
• Official Symbol: CPLX4
• Synonyms: CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683
• Gene ID: 339302
• mRNA Refseq: NM_181654
• Protein Refseq: NP_857637
• MIM: 609586
• UniProt ID: Q7Z7G2