Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CPLX4-364H
Product Overview : CPLX4 MS Standard C13 and N15-labeled recombinant protein (NP_857637) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009]
Molecular Mass : 18.3 kDa
AA Sequence : MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CPLX4 complexin 4 [ Homo sapiens (human) ]
Official Symbol CPLX4
Synonyms CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683;
Gene ID 339302
mRNA Refseq NM_181654
Protein Refseq NP_857637
MIM 609586
UniProt ID Q7Z7G2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPLX4 Products

Required fields are marked with *

My Review for All CPLX4 Products

Required fields are marked with *

0
cart-icon
0
compare icon