Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CPLX4-364H |
| Product Overview : | CPLX4 MS Standard C13 and N15-labeled recombinant protein (NP_857637) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009] |
| Molecular Mass : | 18.3 kDa |
| AA Sequence : | MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CPLX4 complexin 4 [ Homo sapiens (human) ] |
| Official Symbol | CPLX4 |
| Synonyms | CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683; |
| Gene ID | 339302 |
| mRNA Refseq | NM_181654 |
| Protein Refseq | NP_857637 |
| MIM | 609586 |
| UniProt ID | Q7Z7G2 |
| ◆ Recombinant Proteins | ||
| Cplx4-834M | Recombinant Mouse Cplx4 Protein, His&GST-tagged | +Inquiry |
| CPLX4-364H | Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CPLX4-1930M | Recombinant Mouse CPLX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cplx4-2288M | Recombinant Mouse Cplx4 Protein, Myc/DDK-tagged | +Inquiry |
| CPLX4-1788H | Recombinant Human CPLX4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPLX4-7311HCL | Recombinant Human CPLX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPLX4 Products
Required fields are marked with *
My Review for All CPLX4 Products
Required fields are marked with *
