Recombinant Human CPN1 protein, His-tagged

Cat.No. : CPN1-5222H
Product Overview : Recombinant Human CPN1 protein(P15169)(21-458aa), fused with C-terminal His tag, was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 21-458aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 56.2 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Gene Name CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ]
Official Symbol CPN1
Synonyms CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792;
Gene ID 1369
mRNA Refseq NM_001308
Protein Refseq NP_001299
MIM 603103
UniProt ID P15169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPN1 Products

Required fields are marked with *

My Review for All CPN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon