Recombinant Human CPSF4 protein, GST-tagged
| Cat.No. : | CPSF4-2725H |
| Product Overview : | Recombinant Human CPSF4 protein(O95639)(1-244aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-244aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.5 kDa |
| AA Sequence : | MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CPSF4 cleavage and polyadenylation specific factor 4, 30kDa [ Homo sapiens ] |
| Official Symbol | CPSF4 |
| Synonyms | CPSF4; cleavage and polyadenylation specific factor 4, 30kDa; cleavage and polyadenylation specific factor 4, 30kD subunit; cleavage and polyadenylation specificity factor subunit 4; CPSF30; NAR; neb-1; no arches homolog; CPSF 30 kDa subunit; no arches-like zinc finger protein; NS1 effector domain-binding protein 1; cleavage-polyadenylation specificity factor, 30kD; cleavage and polyadenylation specificity factor 30 kDa subunit; NEB1; |
| Gene ID | 10898 |
| mRNA Refseq | NM_001081559 |
| Protein Refseq | NP_001075028 |
| MIM | 603052 |
| UniProt ID | O95639 |
| ◆ Recombinant Proteins | ||
| CPSF4-835R | Recombinant Rhesus Macaque CPSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CPSF4-1232R | Recombinant Rat CPSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CPSF4-1575R | Recombinant Rat CPSF4 Protein | +Inquiry |
| CPSF4-3313H | Recombinant Human CPSF4 Protein, GST/His-tagged | +Inquiry |
| CPSF4-2210HF | Recombinant Full Length Human CPSF4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPSF4-7302HCL | Recombinant Human CPSF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPSF4 Products
Required fields are marked with *
My Review for All CPSF4 Products
Required fields are marked with *
