Recombinant Human CPSF4 protein, GST-tagged

Cat.No. : CPSF4-2725H
Product Overview : Recombinant Human CPSF4 protein(O95639)(1-244aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-244aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.5 kDa
AA Sequence : MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CPSF4 cleavage and polyadenylation specific factor 4, 30kDa [ Homo sapiens ]
Official Symbol CPSF4
Synonyms CPSF4; cleavage and polyadenylation specific factor 4, 30kDa; cleavage and polyadenylation specific factor 4, 30kD subunit; cleavage and polyadenylation specificity factor subunit 4; CPSF30; NAR; neb-1; no arches homolog; CPSF 30 kDa subunit; no arches-like zinc finger protein; NS1 effector domain-binding protein 1; cleavage-polyadenylation specificity factor, 30kD; cleavage and polyadenylation specificity factor 30 kDa subunit; NEB1;
Gene ID 10898
mRNA Refseq NM_001081559
Protein Refseq NP_001075028
MIM 603052
UniProt ID O95639

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPSF4 Products

Required fields are marked with *

My Review for All CPSF4 Products

Required fields are marked with *

0
cart-icon