Recombinant Human CPSF4 protein, GST-tagged

• Cat.No.: CPSF4-2725H
• Product Overview: Recombinant Human CPSF4 protein(O95639)(1-244aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-244aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.5 kDa
• AA Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CPSF4 cleavage and polyadenylation specific factor 4, 30kDa [ Homo sapiens ]
• Official Symbol: CPSF4
• Synonyms: CPSF4; cleavage and polyadenylation specific factor 4, 30kDa; cleavage and polyadenylation specific factor 4, 30kD subunit; cleavage and polyadenylation specificity factor subunit 4; CPSF30; NAR; neb-1; no arches homolog; CPSF 30 kDa subunit; no arches-like zinc finger protein; NS1 effector domain-binding protein 1; cleavage-polyadenylation specificity factor, 30kD; cleavage and polyadenylation specificity factor 30 kDa subunit; NEB1
• Gene ID: 10898
• mRNA Refseq: NM_001081559
• Protein Refseq: NP_001075028
• MIM: 603052
• UniProt ID: O95639