Recombinant Human CPSF6 protein, GST-tagged
Cat.No. : | CPSF6-1848H |
Product Overview : | Recombinant Human CPSF6(37 a.a. - 136 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 37-136 a.a. |
Description : | The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILE IKFFENRANGQSKGFALVGVGSEAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CPSF6 cleavage and polyadenylation specific factor 6, 68kDa [ Homo sapiens ] |
Official Symbol | CPSF6 |
Synonyms | CPSF6; cleavage and polyadenylation specific factor 6, 68kDa; cleavage and polyadenylation specific factor 6, 68kD subunit; cleavage and polyadenylation specificity factor subunit 6; CFIM; CFIM68; HPBRII 4; HPBRII 7; protein HPBRII-4/7; CPSF 68 kDa subunit; pre-mRNA cleavage factor Im (68kD); pre-mRNA cleavage factor I, 68kD subunit; pre-mRNA cleavage factor Im 68 kDa subunit; cleavage and polyadenylation specificity factor 68 kDa subunit; HPBRII-4; HPBRII-7; |
Gene ID | 11052 |
mRNA Refseq | NM_007007 |
Protein Refseq | NP_008938 |
MIM | 604979 |
UniProt ID | Q16630 |
Chromosome Location | 12q15 |
Pathway | mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem; |
Function | contributes_to RNA binding; mRNA binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
Cpsf6-2297M | Recombinant Mouse Cpsf6 Protein, Myc/DDK-tagged | +Inquiry |
CPSF6-1849H | Recombinant Human CPSF6 protein, GST-tagged | +Inquiry |
CPSF6-2629Z | Recombinant Zebrafish CPSF6 | +Inquiry |
CPSF6-1848H | Recombinant Human CPSF6 protein, GST-tagged | +Inquiry |
CPSF6-3335C | Recombinant Chicken CPSF6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPSF6 Products
Required fields are marked with *
My Review for All CPSF6 Products
Required fields are marked with *