Recombinant Human CPT1C protein, His-tagged
| Cat.No. : | CPT1C-3179H |
| Product Overview : | Recombinant Human CPT1C protein(293-442 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 293-442 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CPT1C carnitine palmitoyltransferase 1C [ Homo sapiens ] |
| Official Symbol | CPT1C |
| Synonyms | CPT1C; carnitine palmitoyltransferase 1C; carnitine O-palmitoyltransferase 1, brain isoform; CPT1P; CPTIC; FLJ23809; carnitine palmitoyltransferase I related C; carnitine O-palmitoyltransferase I, brain isoform; CATL1; CPT1-B; CPTI-B; |
| Gene ID | 126129 |
| mRNA Refseq | NM_001136052 |
| Protein Refseq | NP_001129524 |
| MIM | 608846 |
| UniProt ID | Q8TCG5 |
| ◆ Recombinant Proteins | ||
| Cpt1c-837R | Recombinant Rat Cpt1c Protein, His-tagged | +Inquiry |
| CPT1C-1235R | Recombinant Rat CPT1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL4702MF | Recombinant Full Length Mouse Carnitine O-Palmitoyltransferase 1, Brain Isoform(Cpt1C) Protein, His-Tagged | +Inquiry |
| Cpt1c-2299M | Recombinant Mouse Cpt1c Protein, Myc/DDK-tagged | +Inquiry |
| CPT1C-5246H | Recombinant Human CPT1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPT1C-7298HCL | Recombinant Human CPT1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPT1C Products
Required fields are marked with *
My Review for All CPT1C Products
Required fields are marked with *
