Recombinant Human CPT2

• Cat.No.: CPT2-26983TH
• Product Overview: Recombinant fragment corresponding to amino acids 351-450 of Human CPT2, with a N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH05172

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: WFDKSFNLIIAKDGSTAIHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
• Sequence Similarities: Belongs to the carnitine/choline acetyltransferase family.

Gene Information

• Gene Name: CPT2 carnitine palmitoyltransferase 2 [ Homo sapiens ]
• Official Symbol: CPT2
• Synonyms: CPT2; carnitine palmitoyltransferase 2; carnitine palmitoyltransferase II , CPT1; carnitine O-palmitoyltransferase 2, mitochondrial; CPTASE
• Gene ID: 1376
• mRNA Refseq: NM_000098
• Protein Refseq: NP_000089
• MIM: 600650
• Uniprot ID: P23786
• Chromosome Location: 1p32
• Pathway: Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Import of palmitoyl-CoA into the mitochondrial matrix, organism-specific biosystem
• Function: carnitine O-palmitoyltransferase activity; transferase activity, transferring acyl groups