Recombinant Human CPT2
Cat.No. : | CPT2-26983TH |
Product Overview : | Recombinant fragment corresponding to amino acids 351-450 of Human CPT2, with a N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH05172 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WFDKSFNLIIAKDGSTAIHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR |
Sequence Similarities : | Belongs to the carnitine/choline acetyltransferase family. |
Gene Name | CPT2 carnitine palmitoyltransferase 2 [ Homo sapiens ] |
Official Symbol | CPT2 |
Synonyms | CPT2; carnitine palmitoyltransferase 2; carnitine palmitoyltransferase II , CPT1; carnitine O-palmitoyltransferase 2, mitochondrial; CPTASE; |
Gene ID | 1376 |
mRNA Refseq | NM_000098 |
Protein Refseq | NP_000089 |
MIM | 600650 |
Uniprot ID | P23786 |
Chromosome Location | 1p32 |
Pathway | Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Import of palmitoyl-CoA into the mitochondrial matrix, organism-specific biosystem; |
Function | carnitine O-palmitoyltransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
CPT2-1236R | Recombinant Rat CPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPT2-1949M | Recombinant Mouse CPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPT2-5654H | Recombinant Human CPT2 protein, His&Myc-tagged | +Inquiry |
CPT2-2943C | Recombinant Chicken CPT2 | +Inquiry |
CPT2-1821H | Recombinant Human CPT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPT2-391HCL | Recombinant Human CPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPT2 Products
Required fields are marked with *
My Review for All CPT2 Products
Required fields are marked with *
0
Inquiry Basket