Recombinant Human CPT2

Cat.No. : CPT2-26983TH
Product Overview : Recombinant fragment corresponding to amino acids 351-450 of Human CPT2, with a N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH05172
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WFDKSFNLIIAKDGSTAIHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Sequence Similarities : Belongs to the carnitine/choline acetyltransferase family.
Gene Name CPT2 carnitine palmitoyltransferase 2 [ Homo sapiens ]
Official Symbol CPT2
Synonyms CPT2; carnitine palmitoyltransferase 2; carnitine palmitoyltransferase II , CPT1; carnitine O-palmitoyltransferase 2, mitochondrial; CPTASE;
Gene ID 1376
mRNA Refseq NM_000098
Protein Refseq NP_000089
MIM 600650
Uniprot ID P23786
Chromosome Location 1p32
Pathway Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Import of palmitoyl-CoA into the mitochondrial matrix, organism-specific biosystem;
Function carnitine O-palmitoyltransferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPT2 Products

Required fields are marked with *

My Review for All CPT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon