"CRABP2" Related Products

Expand
Expand
Expand

Recombinant Human CRABP2 Protein, GST-tagged

Cat.No.: CRABP2-1830H
Product Overview: Human CRABP2 full-length ORF ( NP_001869.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 42.1 kDa
AA Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CRABP2 cellular retinoic acid binding protein 2 [ Homo sapiens ]
Official Symbol: CRABP2
Synonyms: CRABP2; cellular retinoic acid binding protein 2; cellular retinoic acid-binding protein 2; CRABP II; cellular retinoic acid-binding protein II; RBP6; CRABP-II;
Gene ID: 1382
mRNA Refseq: NM_001199723
Protein Refseq: NP_001186652
MIM: 180231
UniProt ID: P29373

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.