Recombinant Human CRBN protein, His-tagged
Cat.No. : | CRBN-5733H |
Product Overview : | Recombinant Human CRBN protein(Q96SW2)(318-426aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 318-426a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI |
Gene Name | CRBN cereblon [ Homo sapiens ] |
Official Symbol | CRBN |
Synonyms | CRBN; cereblon; mental retardation, non syndromic, autosomal recessive, 2A , MRT2A; protein cereblon; protein x 0001; MRT2; MRT2A; MGC27358; DKFZp781K0715; |
Gene ID | 51185 |
mRNA Refseq | NM_001173482 |
Protein Refseq | NP_001166953 |
MIM | 609262 |
UniProt ID | Q96SW2 |
◆ Recombinant Proteins | ||
CRBN-798HFL | Recombinant Full Length Human CRBN Protein, C-Flag-tagged | +Inquiry |
CRBN-843R | Recombinant Rhesus Macaque CRBN Protein, His (Fc)-Avi-tagged | +Inquiry |
CRBN-1018R | Recombinant Rhesus monkey CRBN Protein, His-tagged | +Inquiry |
CRBN-2793H | Recombinant Human CRBN Full Length Transmembrane protein, C-9xHis-tagged | +Inquiry |
Crbn-838M | Recombinant Mouse Crbn Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRBN-395HCL | Recombinant Human CRBN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRBN Products
Required fields are marked with *
My Review for All CRBN Products
Required fields are marked with *
0
Inquiry Basket