Recombinant Human CRBN protein, His-tagged
| Cat.No. : | CRBN-5733H |
| Product Overview : | Recombinant Human CRBN protein(Q96SW2)(318-426aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 318-426a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI |
| Gene Name | CRBN cereblon [ Homo sapiens ] |
| Official Symbol | CRBN |
| Synonyms | CRBN; cereblon; mental retardation, non syndromic, autosomal recessive, 2A , MRT2A; protein cereblon; protein x 0001; MRT2; MRT2A; MGC27358; DKFZp781K0715; |
| Gene ID | 51185 |
| mRNA Refseq | NM_001173482 |
| Protein Refseq | NP_001166953 |
| MIM | 609262 |
| UniProt ID | Q96SW2 |
| ◆ Recombinant Proteins | ||
| CRBN-843R | Recombinant Rhesus Macaque CRBN Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRBN-001H | Active Recombinant Human DDB1/CRBN Complex Protein | +Inquiry |
| Crbn-6854R | Recombinant Rat Crbn protein, His-tagged | +Inquiry |
| CRBN-2793H | Recombinant Human CRBN Full Length Transmembrane protein, C-9xHis-tagged | +Inquiry |
| CRBN-1195Z | Recombinant Zebrafish CRBN | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRBN-395HCL | Recombinant Human CRBN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRBN Products
Required fields are marked with *
My Review for All CRBN Products
Required fields are marked with *
