Recombinant Human CRCP protein, His-tagged
Cat.No. : | CRCP-3752H |
Product Overview : | Recombinant Human CRCP protein(1-115 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-115 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRCP CGRP receptor component [ Homo sapiens ] |
Official Symbol | CRCP |
Synonyms | CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194; |
Gene ID | 27297 |
mRNA Refseq | NM_001040647 |
Protein Refseq | NP_001035737 |
MIM | 606121 |
UniProt ID | O75575 |
◆ Recombinant Proteins | ||
CRCP-1587R | Recombinant Rat CRCP Protein | +Inquiry |
CRCP-1838H | Recombinant Human CRCP Protein, His-tagged | +Inquiry |
CRCP-3884M | Recombinant Mouse CRCP Protein | +Inquiry |
CRCP-3752H | Recombinant Human CRCP protein, His-tagged | +Inquiry |
CRCP-4225H | Recombinant Human CRCP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRCP-7291HCL | Recombinant Human CRCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRCP Products
Required fields are marked with *
My Review for All CRCP Products
Required fields are marked with *