Recombinant Human CREBBP protein, GST-tagged

Cat.No. : CREBBP-194H
Product Overview : Recombinant Human CREBBP(a.a: 1081–1197) fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : 40 mM Tris-HCl pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20 and 20% glycerol.
Molecular Mass : 41 kDa
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Purity : > 96%
Applications : Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Storage : >6 months at –80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.23 mg/ml
Gene Name CREBBP CREB binding protein [ Homo sapiens ]
Official Symbol CREBBP
Synonyms CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS;
Gene ID 1387
mRNA Refseq NM_004380
Protein Refseq NP_004371
MIM 600140
UniProt ID Q92793
Chromosome Location 16p13.3
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Angiogenesis, organism-specific biosystem; BMAL1:CLOCK/NPAS2 Activates Circadian Expression, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell cycle, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CREBBP Products

Required fields are marked with *

My Review for All CREBBP Products

Required fields are marked with *

0
cart-icon