Recombinant Human CREBBP protein, GST-tagged
Cat.No. : | CREBBP-194H |
Product Overview : | Recombinant Human CREBBP(a.a: 1081–1197) fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | 40 mM Tris-HCl pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20 and 20% glycerol. |
Molecular Mass : | 41 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
Purity : | > 96% |
Applications : | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
Storage : | >6 months at –80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.23 mg/ml |
Gene Name | CREBBP CREB binding protein [ Homo sapiens ] |
Official Symbol | CREBBP |
Synonyms | CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS; |
Gene ID | 1387 |
mRNA Refseq | NM_004380 |
Protein Refseq | NP_004371 |
MIM | 600140 |
UniProt ID | Q92793 |
Chromosome Location | 16p13.3 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Angiogenesis, organism-specific biosystem; BMAL1:CLOCK/NPAS2 Activates Circadian Expression, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell cycle, organism-specific biosystem; |
◆ Recombinant Proteins | ||
CREBBP-193H | Recombinant Human CREBBP protein, His-Flag-tagged | +Inquiry |
CREBBP-2815H | Recombinant Human CREBBP protein, His&FLAG-tagged | +Inquiry |
CREBBP-194H | Recombinant Human CREBBP protein, GST-tagged | +Inquiry |
Crebbp-168M | Active Recombinant Mouse Crebbp, His-tagged | +Inquiry |
Crebbp-2103M | Recombinant Mouse CREB Binding Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBBP Products
Required fields are marked with *
My Review for All CREBBP Products
Required fields are marked with *