Recombinant Human CREBBP protein, GST-tagged
| Cat.No. : | CREBBP-194H |
| Product Overview : | Recombinant Human CREBBP(a.a: 1081–1197) fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | 40 mM Tris-HCl pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20 and 20% glycerol. |
| Molecular Mass : | 41 kDa |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
| Purity : | > 96% |
| Applications : | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
| Storage : | >6 months at –80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.23 mg/ml |
| Gene Name | CREBBP CREB binding protein [ Homo sapiens ] |
| Official Symbol | CREBBP |
| Synonyms | CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS; |
| Gene ID | 1387 |
| mRNA Refseq | NM_004380 |
| Protein Refseq | NP_004371 |
| MIM | 600140 |
| UniProt ID | Q92793 |
| Chromosome Location | 16p13.3 |
| Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Angiogenesis, organism-specific biosystem; BMAL1:CLOCK/NPAS2 Activates Circadian Expression, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell cycle, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| CREBBP-847R | Recombinant Rhesus Macaque CREBBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Crebbp-1115M | Recombinant Mouse Crebbp protein, His-tagged | +Inquiry |
| CREBBP-22HCL | Recombinant Human CREBBP 293 Cell Lysate | +Inquiry |
| Crebbp-168M | Active Recombinant Mouse Crebbp, His-tagged | +Inquiry |
| CREBBP-1412H | Recombinant Human CREBBP protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBBP Products
Required fields are marked with *
My Review for All CREBBP Products
Required fields are marked with *
