Recombinant Human CRELD2 protein, His-tagged
| Cat.No. : | CRELD2-2849H |
| Product Overview : | Recombinant Human CRELD2 protein(91 - 226 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91 - 226 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | NQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CRELD2 cysteine-rich with EGF-like domains 2 [ Homo sapiens ] |
| Official Symbol | CRELD2 |
| Synonyms | CRELD2; cysteine-rich with EGF-like domains 2; cysteine-rich with EGF-like domain protein 2; MGC11256; DKFZp667O055; |
| Gene ID | 79174 |
| mRNA Refseq | NM_001135101 |
| Protein Refseq | NP_001128573 |
| MIM | 607171 |
| UniProt ID | Q6UXH1 |
| ◆ Recombinant Proteins | ||
| CRELD2-1595R | Recombinant Rat CRELD2 Protein | +Inquiry |
| CRELD2-1252R | Recombinant Rat CRELD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRELD2-3327H | Recombinant Human CRELD2 Protein, MYC/DDK-tagged | +Inquiry |
| CRELD2-4343C | Recombinant Chicken CRELD2 | +Inquiry |
| Creld2-986M | Active Recombinant Mouse Creld2 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRELD2-001MCL | Recombinant Mouse CRELD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRELD2 Products
Required fields are marked with *
My Review for All CRELD2 Products
Required fields are marked with *
