| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 298 amino acids | 
                                
                                    | Description : | Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. | 
                                
                                    | Conjugation : | HIS | 
                                
                                    | Molecular Weight : | 34.530kDa inclusive of tags | 
                                
                                    | Form : | Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the ce | 
                                
                                    | Storage buffer : | Preservative: NoneConstituents: 20mM Sodium chloride, 20mM Tris, pH 7.5 | 
                                
                                    | Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
                                
                                    | Sequences of amino acids : | MKHHHHHHASYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL |