Recombinant Human CRHBP, His-tagged

• Cat.No.: CRHBP-27121TH
• Product Overview: Recombinant full length Human CRHBP with an N terminal His tag; 308 amino acids with tag, Predicted MWt 34.53 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 298 amino acids
• Description: Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.
• Conjugation: HIS
• Molecular Weight: 34.530kDa inclusive of tags
• Form: Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the ce
• Storage buffer: Preservative: NoneConstituents: 20mM Sodium chloride, 20mM Tris, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKHHHHHHASYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Gene Information

• Gene Name: CRHBP corticotropin releasing hormone binding protein [ Homo sapiens ]
• Official Symbol: CRHBP
• Synonyms: CRHBP; corticotropin releasing hormone binding protein; corticotropin-releasing factor-binding protein; CRF BP; CRFBP
• Gene ID: 1393
• mRNA Refseq: NM_001882
• Protein Refseq: NP_001873
• MIM: 122559
• Uniprot ID: P24387
• Chromosome Location: 5q
• Function: corticotropin-releasing hormone binding