Recombinant Human CRHBP, His-tagged

Cat.No. : CRHBP-27121TH
Product Overview : Recombinant full length Human CRHBP with an N terminal His tag; 308 amino acids with tag, Predicted MWt 34.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 298 amino acids
Description : Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.
Conjugation : HIS
Molecular Weight : 34.530kDa inclusive of tags
Form : Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the ce
Storage buffer : Preservative: NoneConstituents: 20mM Sodium chloride, 20mM Tris, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKHHHHHHASYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Gene Name CRHBP corticotropin releasing hormone binding protein [ Homo sapiens ]
Official Symbol CRHBP
Synonyms CRHBP; corticotropin releasing hormone binding protein; corticotropin-releasing factor-binding protein; CRF BP; CRFBP;
Gene ID 1393
mRNA Refseq NM_001882
Protein Refseq NP_001873
MIM 122559
Uniprot ID P24387
Chromosome Location 5q
Function corticotropin-releasing hormone binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRHBP Products

Required fields are marked with *

My Review for All CRHBP Products

Required fields are marked with *

0
cart-icon