Recombinant Human CRIM1 Protein, GST-tagged
Cat.No. : | CRIM1-1873H |
Product Overview : | Human CRIM1 partial ORF ( NP_057525, 36 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transmembrane protein containing six cysteine-rich repeat domains and an insulin-like growth factor-binding domain. The encoded protein may play a role in tissue development though interactions with members of the transforming growth factor beta family, such as bone morphogenetic proteins. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRIM1 reserved [ Homo sapiens ] |
Official Symbol | CRIM1 |
Synonyms | CRIM1; reserved; |
Gene ID | 51232 |
mRNA Refseq | NM_016441 |
Protein Refseq | NP_057525 |
MIM | 606189 |
UniProt ID | Q9NZV1 |
◆ Recombinant Proteins | ||
CRIM1-1873H | Recombinant Human CRIM1 Protein, GST-tagged | +Inquiry |
CRIM1-5995C | Recombinant Chicken CRIM1 | +Inquiry |
CRIM1-12087Z | Recombinant Zebrafish CRIM1 | +Inquiry |
CRIM1-1975M | Recombinant Mouse CRIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIM1-11574H | Recombinant Human CRIM1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIM1 Products
Required fields are marked with *
My Review for All CRIM1 Products
Required fields are marked with *