Recombinant Human CRIM1 Protein, GST-tagged

Cat.No. : CRIM1-1873H
Product Overview : Human CRIM1 partial ORF ( NP_057525, 36 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transmembrane protein containing six cysteine-rich repeat domains and an insulin-like growth factor-binding domain. The encoded protein may play a role in tissue development though interactions with members of the transforming growth factor beta family, such as bone morphogenetic proteins. [provided by RefSeq, Nov 2010]
Molecular Mass : 37.84 kDa
AA Sequence : VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRIM1 reserved [ Homo sapiens ]
Official Symbol CRIM1
Synonyms CRIM1; reserved;
Gene ID 51232
mRNA Refseq NM_016441
Protein Refseq NP_057525
MIM 606189
UniProt ID Q9NZV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIM1 Products

Required fields are marked with *

My Review for All CRIM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon