Recombinant Human CRIP1

Cat.No. : CRIP1-27819TH
Product Overview : Recombinant full length Human CRIP1 with N terminal proprietary tag; Predicted MWt 34.58 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 77 amino acids
Description : Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386).
Molecular Weight : 34.580kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Sequence Similarities : Contains 1 LIM zinc-binding domain.
Gene Name CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ]
Official Symbol CRIP1
Synonyms CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP;
Gene ID 1396
mRNA Refseq NM_001311
Protein Refseq NP_001302
MIM 123875
Uniprot ID P50238
Chromosome Location 14q32.33
Function AT DNA binding; DNA bending activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIP1 Products

Required fields are marked with *

My Review for All CRIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon