Recombinant Human CRIP1

• Cat.No.: CRIP1-27819TH
• Product Overview: Recombinant full length Human CRIP1 with N terminal proprietary tag; Predicted MWt 34.58 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 77 amino acids
• Description: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386).
• Molecular Weight: 34.580kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
• Sequence Similarities: Contains 1 LIM zinc-binding domain.

Gene Information

• Gene Name: CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ]
• Official Symbol: CRIP1
• Synonyms: CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP
• Gene ID: 1396
• mRNA Refseq: NM_001311
• Protein Refseq: NP_001302
• MIM: 123875
• Uniprot ID: P50238
• Chromosome Location: 14q32.33
• Function: AT DNA binding; DNA bending activity; metal ion binding; zinc ion binding