Recombinant Human CRIP2 protein, GST-tagged
Cat.No. : | CRIP2-1238H |
Product Overview : | Recombinant Human CRIP2 protein(1-208 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-208 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRIP2 cysteine-rich protein 2 [ Homo sapiens ] |
Official Symbol | CRIP2 |
Synonyms | CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP; |
Gene ID | 1397 |
mRNA Refseq | NM_001312 |
Protein Refseq | NP_001303 |
MIM | 601183 |
UniProt ID | P52943 |
◆ Recombinant Proteins | ||
CRIP2-1600R | Recombinant Rat CRIP2 Protein | +Inquiry |
CRIP2-2056HF | Recombinant Full Length Human CRIP2 Protein, GST-tagged | +Inquiry |
CRIP2-1257R | Recombinant Rat CRIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP2-3051H | Recombinant Human Cysteine-rich Protein 2, His-tagged | +Inquiry |
CRIP2-1238H | Recombinant Human CRIP2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIP2 Products
Required fields are marked with *
My Review for All CRIP2 Products
Required fields are marked with *