Recombinant Human CRIPT protein, GST-tagged
| Cat.No. : | CRIPT-11578H |
| Product Overview : | Recombinant Human CRIPT protein(1-101 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-101 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CRIPT cysteine-rich PDZ-binding protein [ Homo sapiens ] |
| Official Symbol | CRIPT |
| Synonyms | CRIPT; cysteine-rich PDZ-binding protein; HSPC139; postsynaptic protein CRIPT; cysteine-rich interactor of PDZ3; cysteine-rich interactor of PDZ three; |
| Gene ID | 9419 |
| mRNA Refseq | NM_014171 |
| Protein Refseq | NP_054890 |
| MIM | 604594 |
| UniProt ID | Q9P021 |
| ◆ Recombinant Proteins | ||
| CRIPT-1879H | Recombinant Human CRIPT Protein, GST-tagged | +Inquiry |
| CRIPT-6777H | Recombinant Human Cysteine-rich PDZ-binding Protein, His-tagged | +Inquiry |
| CRIPT-2611Z | Recombinant Zebrafish CRIPT | +Inquiry |
| CRIPT-1978M | Recombinant Mouse CRIPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRIPT-1601R | Recombinant Rat CRIPT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRIPT-201HCL | Recombinant Human CRIPT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIPT Products
Required fields are marked with *
My Review for All CRIPT Products
Required fields are marked with *
