Recombinant Human CROT Protein (1-87 aa), GST-tagged
Cat.No. : | CROT-2122H |
Product Overview : | Recombinant Human CROT Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-87 aa |
Description : | Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CROT carnitine O-octanoyltransferase [ Homo sapiens ] |
Official Symbol | CROT |
Synonyms | CROT; carnitine O-octanoyltransferase; COT; |
Gene ID | 54677 |
mRNA Refseq | NM_001143935 |
Protein Refseq | NP_001137407 |
MIM | 606090 |
UniProt ID | Q9UKG9 |
◆ Recombinant Proteins | ||
CROT-1243HFL | Recombinant Full Length Human CROT Protein, C-Flag-tagged | +Inquiry |
CROT-2148H | Recombinant Human CROT Protein (Lys410-Leu612), N-His tagged | +Inquiry |
CROT-3323H | Recombinant Human CROT Protein, MYC/DDK-tagged | +Inquiry |
CROT-2738H | Recombinant Human CROT Protein, His (Fc)-Avi-tagged | +Inquiry |
CROT-287H | Recombinant Human Carnitine O-octanoyltransferase, GST-tagged, Active | +Inquiry |
◆ Cell & Tissue Lysates | ||
CROT-516HCL | Recombinant Human CROT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CROT Products
Required fields are marked with *
My Review for All CROT Products
Required fields are marked with *
0
Inquiry Basket