Recombinant Human CROT Protein (1-87 aa), GST-tagged

Cat.No. : CROT-2122H
Product Overview : Recombinant Human CROT Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-87 aa
Description : Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.2 kDa
AA Sequence : MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CROT carnitine O-octanoyltransferase [ Homo sapiens ]
Official Symbol CROT
Synonyms CROT; carnitine O-octanoyltransferase; COT;
Gene ID 54677
mRNA Refseq NM_001143935
Protein Refseq NP_001137407
MIM 606090
UniProt ID Q9UKG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CROT Products

Required fields are marked with *

My Review for All CROT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon