Recombinant Human CROT Protein (1-87 aa), GST-tagged
| Cat.No. : | CROT-2122H |
| Product Overview : | Recombinant Human CROT Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-87 aa |
| Description : | Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 37.2 kDa |
| AA Sequence : | MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | CROT carnitine O-octanoyltransferase [ Homo sapiens ] |
| Official Symbol | CROT |
| Synonyms | CROT; carnitine O-octanoyltransferase; COT; |
| Gene ID | 54677 |
| mRNA Refseq | NM_001143935 |
| Protein Refseq | NP_001137407 |
| MIM | 606090 |
| UniProt ID | Q9UKG9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CROT Products
Required fields are marked with *
My Review for All CROT Products
Required fields are marked with *



