Recombinant Human CRTAC1 protein, GST-tagged
Cat.No. : | CRTAC1-7866H |
Product Overview : | Recombinant Human CRTAC1 protein(198-332 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 198-332 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens ] |
Official Symbol | CRTAC1 |
Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC1; CEP 68; FLJ10320; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68; ASPIC; CEP-68; |
mRNA Refseq | NM_001206528 |
Protein Refseq | NP_001193457 |
MIM | 606276 |
UniProt ID | Q9NQ79 |
Gene ID | 55118 |
◆ Recombinant Proteins | ||
CRTAC1-3320H | Recombinant Human CRTAC1 Protein, MYC/DDK-tagged | +Inquiry |
CRTAC1-001H | Recombinant Full Length Human CRTAC1 Protein, His Tagged | +Inquiry |
CRTAC1-3925M | Recombinant Mouse CRTAC1 Protein | +Inquiry |
CRTAC1-239H | Recombinant Human CRTAC1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRTAC1-3607C | Recombinant Chicken CRTAC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
0
Inquiry Basket