Recombinant Human CRTAC1 Protein, GST-tagged
Cat.No. : | CRTAC1-1911H |
Product Overview : | Human CRTAC1 full-length ORF ( AAH34245.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in culture. The presence of FG-GAP motifs and an RGD integrin-binding motif suggests that this protein may be involved in cell-cell or cell-matrix interactions. Copy number alterations in this gene have been observed in neurofibromatosis type 1-associated glomus tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 74.7 kDa |
AA Sequence : | MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens ] |
Official Symbol | CRTAC1 |
Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC1; CEP 68; FLJ10320; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68; ASPIC; CEP-68; |
Gene ID | 55118 |
mRNA Refseq | NM_001206528 |
Protein Refseq | NP_001193457 |
MIM | 606276 |
UniProt ID | Q9NQ79 |
◆ Recombinant Proteins | ||
CRTAC1-3320H | Recombinant Human CRTAC1 Protein, MYC/DDK-tagged | +Inquiry |
CRTAC1-3925M | Recombinant Mouse CRTAC1 Protein | +Inquiry |
CRTAC1-7866H | Recombinant Human CRTAC1 protein, GST-tagged | +Inquiry |
CRTAC1-3607C | Recombinant Chicken CRTAC1 | +Inquiry |
CRTAC1-1989M | Recombinant Mouse CRTAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
0
Inquiry Basket