Recombinant Human CRTAC1 Protein, GST-tagged
| Cat.No. : | CRTAC1-1911H |
| Product Overview : | Human CRTAC1 full-length ORF ( AAH34245.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in culture. The presence of FG-GAP motifs and an RGD integrin-binding motif suggests that this protein may be involved in cell-cell or cell-matrix interactions. Copy number alterations in this gene have been observed in neurofibromatosis type 1-associated glomus tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 74.7 kDa |
| AA Sequence : | MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens ] |
| Official Symbol | CRTAC1 |
| Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC1; CEP 68; FLJ10320; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68; ASPIC; CEP-68; |
| Gene ID | 55118 |
| mRNA Refseq | NM_001206528 |
| Protein Refseq | NP_001193457 |
| MIM | 606276 |
| UniProt ID | Q9NQ79 |
| ◆ Recombinant Proteins | ||
| CRTAC1-3925M | Recombinant Mouse CRTAC1 Protein | +Inquiry |
| CRTAC1-001H | Recombinant Full Length Human CRTAC1 Protein, His Tagged | +Inquiry |
| CRTAC1-11590H | Recombinant Human CRTAC1, GST-tagged | +Inquiry |
| Crtac1-2320M | Recombinant Mouse Crtac1 Protein, Myc/DDK-tagged | +Inquiry |
| Crtac1-4535M | Recombinant Mouse Crtac1 protein, hFc-SBP-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
