Recombinant Human CRTAC1 protein, His-tagged
| Cat.No. : | CRTAC1-7865H |
| Product Overview : | Recombinant Human CRTAC1 protein(198-332 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 198-332 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens ] |
| Official Symbol | CRTAC1 |
| Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC1; CEP 68; FLJ10320; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68; ASPIC; CEP-68; |
| mRNA Refseq | NM_001206528 |
| Protein Refseq | NP_001193457 |
| MIM | 606276 |
| UniProt ID | Q9NQ79 |
| Gene ID | 55118 |
| ◆ Recombinant Proteins | ||
| CRTAC1-239H | Recombinant Human CRTAC1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Crtac1-4535M | Recombinant Mouse Crtac1 protein, hFc-SBP-tagged | +Inquiry |
| CRTAC1-1911H | Recombinant Human CRTAC1 Protein, GST-tagged | +Inquiry |
| Crtac1-2320M | Recombinant Mouse Crtac1 Protein, Myc/DDK-tagged | +Inquiry |
| CRTAC1-001H | Recombinant Full Length Human CRTAC1 Protein, His Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
