Recombinant Human CRX protein, His-tagged
Cat.No. : | CRX-3854H |
Product Overview : | Recombinant Human CRX protein(166-285 aa), fused to His tag, was expressed in E. coli. |
Availability | August 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 166-285 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRX cone-rod homeobox [ Homo sapiens ] |
Official Symbol | CRX |
Synonyms | CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3; |
Gene ID | 1406 |
mRNA Refseq | NM_000554 |
Protein Refseq | NP_000545 |
MIM | 602225 |
UniProt ID | O43186 |
◆ Recombinant Proteins | ||
CRX-93HF | Recombinant Full Length Human CRX Protein | +Inquiry |
CRX-2124HF | Recombinant Full Length Human CRX Protein, GST-tagged | +Inquiry |
CRX-1919H | Recombinant Human CRX Protein, GST-tagged | +Inquiry |
CRX-3854H | Recombinant Human CRX protein, His-tagged | +Inquiry |
CRX-26343TH | Recombinant Human CRX | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRX-7270HCL | Recombinant Human CRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRX Products
Required fields are marked with *
My Review for All CRX Products
Required fields are marked with *