Recombinant Human CRX protein, His-tagged
| Cat.No. : | CRX-3854H |
| Product Overview : | Recombinant Human CRX protein(166-285 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 166-285 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CRX cone-rod homeobox [ Homo sapiens ] |
| Official Symbol | CRX |
| Synonyms | CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3; |
| Gene ID | 1406 |
| mRNA Refseq | NM_000554 |
| Protein Refseq | NP_000545 |
| MIM | 602225 |
| UniProt ID | O43186 |
| ◆ Recombinant Proteins | ||
| CRX-93HF | Recombinant Full Length Human CRX Protein | +Inquiry |
| CRX-2671H | Recombinant Human CRX Protein (1-299 aa), His-Myc-tagged | +Inquiry |
| CRX-2124HF | Recombinant Full Length Human CRX Protein, GST-tagged | +Inquiry |
| CRX-3854H | Recombinant Human CRX protein, His-tagged | +Inquiry |
| CRX-9413Z | Recombinant Zebrafish CRX | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRX-7270HCL | Recombinant Human CRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRX Products
Required fields are marked with *
My Review for All CRX Products
Required fields are marked with *
