Recombinant Human CRY2 protein, His&Myc-tagged
Cat.No. : | CRY2-2308H |
Product Overview : | Recombinant Human CRY2 protein(Q49AN0)(1-593aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-593aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.8 kDa |
AA Sequence : | MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CRY2 cryptochrome 2 (photolyase-like) [ Homo sapiens ] |
Official Symbol | CRY2 |
Synonyms | CRY2; cryptochrome 2 (photolyase-like); cryptochrome-2; growth-inhibiting protein 37; HCRY2; PHLL2; FLJ10332; KIAA0658; |
Gene ID | 1408 |
mRNA Refseq | NM_001127457 |
Protein Refseq | NP_001120929 |
MIM | 603732 |
UniProt ID | Q49AN0 |
◆ Recombinant Proteins | ||
CRY2-647H | Recombinant Human CRY2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRY2-2308H | Recombinant Human CRY2 protein, His&Myc-tagged | +Inquiry |
CRY2-2390R | Recombinant Rat CRY2 Protein (1-594 aa), His-SUMO-Myc-tagged | +Inquiry |
CRY2-5336HFL | Recombinant Full Length Human CRY2, Flag-tagged | +Inquiry |
CRY2-1609R | Recombinant Rat CRY2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY2-7268HCL | Recombinant Human CRY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY2 Products
Required fields are marked with *
My Review for All CRY2 Products
Required fields are marked with *
0
Inquiry Basket