Recombinant Human CRYAA protein, GST-tagged
Cat.No. : | CRYAA-7877H |
Product Overview : | Recombinant Human CRYAA protein(115-173 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 115-173 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | HRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CRYAA crystallin, alpha A [ Homo sapiens ] |
Official Symbol | CRYAA |
Synonyms | CRYAA; crystallin, alpha A; CRYA1; alpha-crystallin A chain; HSPB4; crystallin, alpha-1; heat shock protein beta-4; human alphaA-crystallin (CRYA1); |
mRNA Refseq | NM_000394 |
Protein Refseq | NP_000385 |
UniProt ID | P02489 |
Gene ID | 1409 |
◆ Recombinant Proteins | ||
CRYAA-26676TH | Recombinant Human CRYAA | +Inquiry |
CRYAA-26991TH | Recombinant Human CRYAA, His-tagged | +Inquiry |
CRYAA-1925H | Recombinant Human CRYAA Protein, GST-tagged | +Inquiry |
CRYAA-2879H | Recombinant Human CRYAA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRYAA-9417Z | Recombinant Zebrafish CRYAA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYAA Products
Required fields are marked with *
My Review for All CRYAA Products
Required fields are marked with *
0
Inquiry Basket