Recombinant Human CRYBA2 protein, His-tagged
| Cat.No. : | CRYBA2-3734H |
| Product Overview : | Recombinant Human CRYBA2 protein(1-197 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-197 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CRYBA2 crystallin, beta A2 [ Homo sapiens ] |
| Official Symbol | CRYBA2 |
| Synonyms | CRYBA2; crystallin, beta A2; beta-crystallin A2; eye lens structural protein; |
| Gene ID | 1412 |
| mRNA Refseq | NM_005209 |
| Protein Refseq | NP_005200 |
| MIM | 600836 |
| UniProt ID | P53672 |
| ◆ Recombinant Proteins | ||
| CRYBA2-5753C | Recombinant Chicken CRYBA2 | +Inquiry |
| Cryba2-2328M | Recombinant Mouse Cryba2 Protein, Myc/DDK-tagged | +Inquiry |
| CRYBA2-1929H | Recombinant Human CRYBA2 Protein, GST-tagged | +Inquiry |
| CRYBA2-1996M | Recombinant Mouse CRYBA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRYBA2-5469H | Recombinant Human CRYBA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYBA2-7264HCL | Recombinant Human CRYBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYBA2 Products
Required fields are marked with *
My Review for All CRYBA2 Products
Required fields are marked with *
