Recombinant Human CRYBA2 protein, His-tagged
Cat.No. : | CRYBA2-3734H |
Product Overview : | Recombinant Human CRYBA2 protein(1-197 aa), fused to His tag, was expressed in E. coli. |
Availability | May 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-197 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRYBA2 crystallin, beta A2 [ Homo sapiens ] |
Official Symbol | CRYBA2 |
Synonyms | CRYBA2; crystallin, beta A2; beta-crystallin A2; eye lens structural protein; |
Gene ID | 1412 |
mRNA Refseq | NM_005209 |
Protein Refseq | NP_005200 |
MIM | 600836 |
UniProt ID | P53672 |
◆ Recombinant Proteins | ||
CRYBA2-864R | Recombinant Rhesus Macaque CRYBA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYBA2-3734H | Recombinant Human CRYBA2 protein, His-tagged | +Inquiry |
CRYBA2-3936M | Recombinant Mouse CRYBA2 Protein | +Inquiry |
Cryba2-2328M | Recombinant Mouse Cryba2 Protein, Myc/DDK-tagged | +Inquiry |
CRYBA2-2130HF | Recombinant Full Length Human CRYBA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYBA2-7264HCL | Recombinant Human CRYBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYBA2 Products
Required fields are marked with *
My Review for All CRYBA2 Products
Required fields are marked with *
0
Inquiry Basket