Recombinant Human CRYZ Protein, GST-tagged
Cat.No. : | CRYZ-1947H |
Product Overview : | Human CRYZ full-length ORF ( NP_001880.2, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq, Sep 2008] |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRYZ crystallin, zeta (quinone reductase) [ Homo sapiens ] |
Official Symbol | CRYZ |
Synonyms | CRYZ; crystallin, zeta (quinone reductase); quinone oxidoreductase; NADPH:quinone reductase; FLJ41475; DKFZp779E0834; |
Gene ID | 1429 |
mRNA Refseq | NM_001130042 |
Protein Refseq | NP_001123514 |
MIM | 123691 |
UniProt ID | Q08257 |
◆ Recombinant Proteins | ||
CRYZ-1947H | Recombinant Human CRYZ Protein, GST-tagged | +Inquiry |
CRYZ-2145HF | Recombinant Full Length Human CRYZ Protein, GST-tagged | +Inquiry |
CRYZ-873R | Recombinant Rhesus Macaque CRYZ Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYZ-257H | Recombinant Human CRYZ, His-tagged | +Inquiry |
CRYZ-3595C | Recombinant Chicken CRYZ | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYZ-408HCL | Recombinant Human CRYZ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYZ Products
Required fields are marked with *
My Review for All CRYZ Products
Required fields are marked with *