Recombinant Human CS protein, His-tagged
Cat.No. : | CS-2738H |
Product Overview : | Recombinant Human CS protein(O75390)(28-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-464aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CS citrate synthase [ Homo sapiens ] |
Official Symbol | CS |
Synonyms | CS; citrate synthase; citrate synthase, mitochondrial; |
Gene ID | 1431 |
mRNA Refseq | NM_004077 |
Protein Refseq | NP_004068 |
MIM | 118950 |
UniProt ID | O75390 |
◆ Recombinant Proteins | ||
CS-2147HF | Recombinant Full Length Human CS Protein, GST-tagged | +Inquiry |
CS-3342H | Recombinant Human CS Protein, MYC/DDK-tagged | +Inquiry |
Cs-1775R | Recombinant Rat Cs protein, His & T7-tagged | +Inquiry |
CS-1950H | Recombinant Human CS Protein, GST-tagged | +Inquiry |
CS-259H | Recombinant Human CS, His-tagged | +Inquiry |
◆ Native Proteins | ||
Cs-164P | Active Native Porcine Citrate Synthase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CS-001HCL | Recombinant Human CS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CS Products
Required fields are marked with *
My Review for All CS Products
Required fields are marked with *
0
Inquiry Basket