Recombinant Human CSF2 Protein

Name: Recombinant Human CSF2 Protein
SKU: CSF2-493H

Species :	Human
Protein Length :	144
Description :	The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis.
Form :	Lyophilized
AA Sequence :	MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens (human) ]
Official Symbol	CSF2
Synonyms	CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897;
Gene ID	1437
mRNA Refseq	NM_000758
Protein Refseq	NP_000749
MIM	138960
UniProt ID	P04141