Recombinant Human CSF2RA Protein, C-His-tagged
| Cat.No. : | CSF2RA-021H |
| Product Overview : | Recombinant Human CSF2RA Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (GM-CSF Receptor α), also known as CSF2RA and CD116, is a type 1 transmembrane protein with low affinity for GM-CSF. GM-CSF Receptor α is primarily expressed on myeloid cells, including granulocytes, monocytes, macrophages, and dendritic cells. GM-CSF Receptor α forms a heterodimeric receptor complex with GM-CSF Receptor β, creating the high affinity GM-CSF receptor. Upon dimerization and ligand binding, the β subunit becomes phosphorylated and transduces signals via Jak/STAT and MAPK pathways for cell proliferation, differentiation, and survival. Oligomerization of the high affinity GM-CSF Receptor α/β complex is required for optimal intracellular signal transduction. Soluble GM-CSF Receptor α, either secreted or cleaved from the cell surface, can competitively bind GM-CSF, preventing membrane receptor signaling. Multiple isoforms of GM-CSF Receptor α have been described. |
| Molecular Mass : | ~33 kDa |
| AA Sequence : | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens (human) ] |
| Official Symbol | CSF2RA |
| Synonyms | CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha; |
| Gene ID | 1438 |
| mRNA Refseq | NM_001161529 |
| Protein Refseq | NP_001155001 |
| MIM | 306250 |
| UniProt ID | P15509 |
| ◆ Recombinant Proteins | ||
| RFL16988HF | Recombinant Full Length Human Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha(Csf2Ra) Protein, His-Tagged | +Inquiry |
| CSF2RA-509H | Recombinant Human CSF2RA protein, His-Avi-tagged | +Inquiry |
| CSF2RA-1544R | Recombinant Rhesus Monkey CSF2RA Protein | +Inquiry |
| CSF2RA-725H | Recombinant Human CSF2RA protein, His-tagged | +Inquiry |
| CSF2RA-27475TH | Recombinant Human CSF2RA | +Inquiry |
| ◆ Native Proteins | ||
| CSF2RA-34H | Active Recombinant Human CSF2RA Homodimer Protein, His&Avi tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF2RA-2713HCL | Recombinant Human CSF2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2RA Products
Required fields are marked with *
My Review for All CSF2RA Products
Required fields are marked with *
