Recombinant Human CSF3

Cat.No. : CSF3-26467TH
Product Overview : Recombinant full length human G-CSF protein expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
Biological activity : The ED50 of CSF3-26467TH is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence:ATPLGPASSLPQSFLLKCLEQVRKIQGDG AALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPS QALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTL QLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAF QRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Sequence Similarities : Belongs to the IL-6 superfamily.
Full Length : Full L.
Gene Name CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
Official Symbol CSF3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin;
Gene ID 1440
mRNA Refseq NM_000759
Protein Refseq NP_000750
MIM 138970
Uniprot ID P09919
Chromosome Location 17q11.2-q12
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF3 Products

Required fields are marked with *

My Review for All CSF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon