Recombinant Human CSF3

• Cat.No.: CSF3-26467TH
• Product Overview: Recombinant full length human G-CSF protein expressed in modified human 293 cells.

Specification

• Species: Human
• Tag: Non
• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
• Biological activity: The ED50 of CSF3-26467TH is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical Sequence:ATPLGPASSLPQSFLLKCLEQVRKIQGDG AALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPS QALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTL QLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAF QRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Sequence Similarities: Belongs to the IL-6 superfamily.
• Full Length: Full L.

Gene Information

• Gene Name: CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
• Official Symbol: CSF3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin
• Gene ID: 1440
• mRNA Refseq: NM_000759
• Protein Refseq: NP_000750
• MIM: 138970
• Uniprot ID: P09919
• Chromosome Location: 17q11.2-q12
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
• Function: cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity