Recombinant Human CSH1 Protein, GST-tagged

Cat.No. : CSH1-1976H
Product Overview : Human CSH1 full-length ORF ( AAH02717, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008]
Molecular Mass : 49.61 kDa
AA Sequence : MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSSCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDTDKVETFLRMVQCRSVEGSCGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ]
Official Symbol CSH1
Synonyms CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); chorionic somatomammotropin hormone; choriomammotropin; chorionic somatomammotropin A; CSA; CSMT; FLJ75407; hCS A; PL; placental lactogen; CS-1; hCS-A;
Gene ID 1442
mRNA Refseq NM_001317
Protein Refseq NP_001308
MIM 150200
UniProt ID P01243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSH1 Products

Required fields are marked with *

My Review for All CSH1 Products

Required fields are marked with *

0
cart-icon