Recombinant Human CSH1 Protein, GST-tagged
Cat.No. : | CSH1-1976H |
Product Overview : | Human CSH1 full-length ORF ( AAH02717, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.61 kDa |
AA Sequence : | MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSSCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDTDKVETFLRMVQCRSVEGSCGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ] |
Official Symbol | CSH1 |
Synonyms | CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); chorionic somatomammotropin hormone; choriomammotropin; chorionic somatomammotropin A; CSA; CSMT; FLJ75407; hCS A; PL; placental lactogen; CS-1; hCS-A; |
Gene ID | 1442 |
mRNA Refseq | NM_001317 |
Protein Refseq | NP_001308 |
MIM | 150200 |
UniProt ID | P01243 |
◆ Recombinant Proteins | ||
CSH1-50B | Recombinant Bovine Chorionic Somatomammotropin Hormone 1 | +Inquiry |
CSH1-5313H | Recombinant Human CSH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSH1-184H | Recombinant Human Placental Lactogen | +Inquiry |
CSH1-1976H | Recombinant Human CSH1 Protein, GST-tagged | +Inquiry |
CSH1-1053R | Recombinant Rhesus monkey CSH1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSH1-2206HCL | Recombinant Human CSH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSH1 Products
Required fields are marked with *
My Review for All CSH1 Products
Required fields are marked with *