Recombinant Human CSHL1 Protein, His-tagged

Cat.No. : CSHL1-001H
Product Overview : CSHL1;chorionic somatomammotropin hormone like 1;CS-5;CSHP1;CSL;GHB4;hCS-L;His-tagged;Human
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 27-222 aa
Description : CSHL1 (chorionic somatomammotropin hormone like 1) is a member of the somatotropin/prolactin family of hormones, playing a role in growth control. It is primarily expressed in placental villi and is involved in growth factor activity, growth hormone receptor binding, and the positive regulation of JAK-STAT receptor signaling pathway.
Form : Liquid
Molecular Mass : 25 kDa (calculated)
AASequence : MGSSHHHHHHSSGLVPRGSHMVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
Endotoxin : <1.0 EU/ug (by LAL)
Purity : >95% (by SDS-PAGE)
Storage : Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles
Concentration : 1 mg/ml (by BCA)
Storage Buffer : Sterile PBS, pH7.4, 0.1% SKL

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSHL1 Products

Required fields are marked with *

My Review for All CSHL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon