Recombinant Human CSHL1 Protein, His-tagged
| Cat.No. : | CSHL1-001H |
| Product Overview : | CSHL1;chorionic somatomammotropin hormone like 1;CS-5;CSHP1;CSL;GHB4;hCS-L;His-tagged;Human |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 27-222 aa |
| Description : | CSHL1 (chorionic somatomammotropin hormone like 1) is a member of the somatotropin/prolactin family of hormones, playing a role in growth control. It is primarily expressed in placental villi and is involved in growth factor activity, growth hormone receptor binding, and the positive regulation of JAK-STAT receptor signaling pathway. |
| Form : | Liquid |
| Molecular Mass : | 25 kDa (calculated) |
| AASequence : | MGSSHHHHHHSSGLVPRGSHMVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF |
| Endotoxin : | <1.0 EU/ug (by LAL) |
| Purity : | >95% (by SDS-PAGE) |
| Storage : | Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles |
| Concentration : | 1 mg/ml (by BCA) |
| Storage Buffer : | Sterile PBS, pH7.4, 0.1% SKL |
| Gene Name | CSHL1 |
| Official Symbol | NM_022579.3 |
| Synonyms | NP_072101.1 |
| Gene ID | https://www.ncbi.nlm.nih.gov/protein/NP_072101.1 |
| mRNA Refseq | https://www.uniprot.org/uniprotkb/Q14406 |
| Protein Refseq | https://www.ncbi.nlm.nih.gov/gene/1444 |
| MIM | https://www.omim.org/entry/603515 |
| ◆ Recombinant Proteins | ||
| CSHL1-13HFL | Recombinant Full Length Human CSHL1 Protein, Tag Free | +Inquiry |
| CSHL1-001H | Recombinant Human CSHL1 Protein, His-tagged | +Inquiry |
| CSHL1-12H | Recombinant Human CSHL1 Protein, His-tagged | +Inquiry |
| CSHL1-11623H | Recombinant Human CSHL1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSHL1-7245HCL | Recombinant Human CSHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSHL1 Products
Required fields are marked with *
My Review for All CSHL1 Products
Required fields are marked with *



