Recombinant Human CSN2 Protein, GST-tagged
Cat.No. : | CSN2-1984H |
Product Overview : | Human CSN2 partial ORF ( NP_001882, 127 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSN2 casein beta [ Homo sapiens ] |
Official Symbol | CSN2 |
Synonyms | CSN2; casein beta; CASB; beta-casein; |
Gene ID | 1447 |
mRNA Refseq | NM_001891 |
Protein Refseq | NP_001882 |
MIM | 115460 |
UniProt ID | P05814 |
◆ Recombinant Proteins | ||
CSN2-2744B | Recombinant Bovine CSN2 protein, His&Myc-tagged | +Inquiry |
CSN2-5541H | Recombinant Human Casein Beta, His-tagged | +Inquiry |
CSN2-2752C | Recombinant Cattle CSN2 Protein, His-tagged | +Inquiry |
CSN2-194H | Recombinant Human CSN2 Protein, His-tagged | +Inquiry |
Csn2-944M | Recombinant Mouse Csn2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSN2-7244HCL | Recombinant Human CSN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSN2 Products
Required fields are marked with *
My Review for All CSN2 Products
Required fields are marked with *