Recombinant Human CSN2 Protein, GST-tagged

Cat.No. : CSN2-1984H
Product Overview : Human CSN2 partial ORF ( NP_001882, 127 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
Molecular Mass : 36.74 kDa
AA Sequence : DPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSN2 casein beta [ Homo sapiens ]
Official Symbol CSN2
Synonyms CSN2; casein beta; CASB; beta-casein;
Gene ID 1447
mRNA Refseq NM_001891
Protein Refseq NP_001882
MIM 115460
UniProt ID P05814

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSN2 Products

Required fields are marked with *

My Review for All CSN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon