Recombinant Human CSNK1G1 Protein, GST-tagged
| Cat.No. : | CSNK1G1-1998H |
| Product Overview : | Human CSNK1G1 partial ORF ( AAH17236, 293 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the casein kinase I gene family. This family is comprised of serine/threonine kinases that phosphorylate acidic proteins such as caseins. The encoded kinase plays a role in cell cycle checkpoint arrest in response to stalled replication forks by phosphorylating Claspin. A mutation in this gene may be associated with non-syndromic early-onset epilepsy (NSEOE). [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CSNK1G1 casein kinase 1, gamma 1 [ Homo sapiens ] |
| Official Symbol | CSNK1G1 |
| Synonyms | CSNK1G1; casein kinase 1, gamma 1; casein kinase I isoform gamma-1; CK1gamma1; CKI-gamma 1; |
| Gene ID | 53944 |
| mRNA Refseq | NM_022048 |
| Protein Refseq | NP_071331 |
| MIM | 606274 |
| UniProt ID | Q9HCP0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK1G1 Products
Required fields are marked with *
My Review for All CSNK1G1 Products
Required fields are marked with *
