Recombinant Human CSNK1G1 Protein, GST-tagged
Cat.No. : | CSNK1G1-1998H |
Product Overview : | Human CSNK1G1 partial ORF ( AAH17236, 293 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the casein kinase I gene family. This family is comprised of serine/threonine kinases that phosphorylate acidic proteins such as caseins. The encoded kinase plays a role in cell cycle checkpoint arrest in response to stalled replication forks by phosphorylating Claspin. A mutation in this gene may be associated with non-syndromic early-onset epilepsy (NSEOE). [provided by RefSeq, Jul 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSNK1G1 casein kinase 1, gamma 1 [ Homo sapiens ] |
Official Symbol | CSNK1G1 |
Synonyms | CSNK1G1; casein kinase 1, gamma 1; casein kinase I isoform gamma-1; CK1gamma1; CKI-gamma 1; |
Gene ID | 53944 |
mRNA Refseq | NM_022048 |
Protein Refseq | NP_071331 |
MIM | 606274 |
UniProt ID | Q9HCP0 |
◆ Recombinant Proteins | ||
CSNK1G1-1924Z | Recombinant Zebrafish CSNK1G1 | +Inquiry |
CSNK1G1-1252C | Recombinant Chicken CSNK1G1 | +Inquiry |
CSNK1G1-1194H | Recombinant Human CSNK1G1 Protein (D2-K422), Tag Free | +Inquiry |
CSNK1G1-4953HF | Active Recombinant Full Length Human CSNK1G1 Protein, GST-tagged | +Inquiry |
CSNK1G1-11630H | Recombinant Human CSNK1G1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1G1-662HCL | Recombinant Human CSNK1G1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSNK1G1 Products
Required fields are marked with *
My Review for All CSNK1G1 Products
Required fields are marked with *
0
Inquiry Basket