Recombinant Human CSRP2 Protein, GST-tagged
| Cat.No. : | CSRP2-2019H |
| Product Overview : | Human CSRP2 full-length ORF ( AAH00992, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Molecular Mass : | 46.97 kDa |
| AA Sequence : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ] |
| Official Symbol | CSRP2 |
| Synonyms | CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; LMO-5; cysteine-rich protein 2; LIM domain only protein 5; smooth muscle cell LIM protein; LIM domain only 5, smooth muscle; |
| Gene ID | 1466 |
| mRNA Refseq | NM_001321 |
| Protein Refseq | NP_001312 |
| MIM | 601871 |
| UniProt ID | Q16527 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *
