Recombinant Human CST6, His-tagged

Cat.No. : CST6-26432TH
Product Overview : Recombinant full length Human CST6 with an N terminal His tag; 142 amino acids with tag, MWt 15.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 121 amino acids
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.
Conjugation : HIS
Molecular Weight : 15.900kDa inclusive of tags
Tissue specificity : Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Sequence Similarities : Belongs to the cystatin family.
Gene Name CST6 cystatin E/M [ Homo sapiens ]
Official Symbol CST6
Synonyms CST6; cystatin E/M; cystatin-M;
Gene ID 1474
mRNA Refseq NM_001323
Protein Refseq NP_001314
MIM 601891
Uniprot ID Q15828
Chromosome Location 11q13
Function cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST6 Products

Required fields are marked with *

My Review for All CST6 Products

Required fields are marked with *

0
cart-icon