Recombinant Human CST6, His-tagged

• Cat.No.: CST6-26432TH
• Product Overview: Recombinant full length Human CST6 with an N terminal His tag; 142 amino acids with tag, MWt 15.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 121 amino acids
• Description: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.
• Conjugation: HIS
• Molecular Weight: 15.900kDa inclusive of tags
• Tissue specificity: Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
• Sequence Similarities: Belongs to the cystatin family.

Gene Information

• Gene Name: CST6 cystatin E/M [ Homo sapiens ]
• Official Symbol: CST6
• Synonyms: CST6; cystatin E/M; cystatin-M
• Gene ID: 1474
• mRNA Refseq: NM_001323
• Protein Refseq: NP_001314
• MIM: 601891
• Uniprot ID: Q15828
• Chromosome Location: 11q13
• Function: cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity