Recombinant Human CSTA protein
Cat.No. : | CSTA-213H |
Product Overview : | Recombinant Human Cystatin A is produced with our E. coli ex |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-98 a.a. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0. |
AA Sequence : | MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
Purity : | > 95 % as determined by SDS-PAGE. |
Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : | Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
Gene Name | CSTA cystatin A [ Homo sapiens ] |
Official Symbol | CSTA |
Synonyms | AREI; STF1; STFA; cystatin A (stefin A); cystatin AS |
Gene ID | 1475 |
mRNA Refseq | NM_005213 |
Protein Refseq | NP_005204 |
MIM | 184600 |
UniProt ID | P01040 |
Chromosome Location | 3q21 |
Function | cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity |
◆ Recombinant Proteins | ||
CSTA-27200TH | Recombinant Human CSTA, His-tagged | +Inquiry |
CSTA-894R | Recombinant Rhesus Macaque CSTA Protein, His (Fc)-Avi-tagged | +Inquiry |
CSTA-1891H | Recombinant Human CSTA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSTA-28192TH | Recombinant Human CSTA | +Inquiry |
CSTA-203H | Active Recombinant Human CSTA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSTA-7225HCL | Recombinant Human CSTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSTA Products
Required fields are marked with *
My Review for All CSTA Products
Required fields are marked with *
0
Inquiry Basket