Recombinant Human CSTA protein

• Cat.No.: CSTA-213H
• Product Overview: Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-98 a.a.
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0.
• AA Sequence: MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF
• Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method.
• Purity: > 95 % as determined by SDS-PAGE.
• Stability: Samples are stable for up to twelve months from date of receipt at -70 centigrade.
• Storage: Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.

Gene Information

• Gene Name: CSTA cystatin A [ Homo sapiens ]
• Official Symbol: CSTA
• Synonyms: AREI; STF1; STFA; cystatin A (stefin A); cystatin AS
• Gene ID: 1475
• mRNA Refseq: NM_005213
• Protein Refseq: NP_005204
• MIM: 184600
• UniProt ID: P01040
• Chromosome Location: 3q21
• Function: cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity