Recombinant Human CSTA protein
| Cat.No. : | CSTA-213H |
| Product Overview : | Recombinant Human Cystatin A is produced with our E. coli ex |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-98 a.a. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0. |
| AA Sequence : | MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
| Purity : | > 95 % as determined by SDS-PAGE. |
| Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
| Storage : | Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
| Gene Name | CSTA cystatin A [ Homo sapiens ] |
| Official Symbol | CSTA |
| Synonyms | AREI; STF1; STFA; cystatin A (stefin A); cystatin AS |
| Gene ID | 1475 |
| mRNA Refseq | NM_005213 |
| Protein Refseq | NP_005204 |
| MIM | 184600 |
| UniProt ID | P01040 |
| Chromosome Location | 3q21 |
| Function | cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity |
| ◆ Recombinant Proteins | ||
| CSTA-27200TH | Recombinant Human CSTA, His-tagged | +Inquiry |
| CSTA-1069R | Recombinant Rhesus monkey CSTA Protein, His-tagged | +Inquiry |
| CSTA-1891H | Recombinant Human CSTA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CSTA-894R | Recombinant Rhesus Macaque CSTA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CSTA-2591H | Active Recombinant Human CSTA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSTA-7225HCL | Recombinant Human CSTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTA Products
Required fields are marked with *
My Review for All CSTA Products
Required fields are marked with *
