Recombinant Human CSTB Protein, GST-tagged
Cat.No. : | CSTB-2038H |
Product Overview : | Human CSTB full-length ORF ( AAH03370.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSTB cystatin B (stefin B) [ Homo sapiens ] |
Official Symbol | CSTB |
Synonyms | CSTB; cystatin B (stefin B); EPM1, STFB; cystatin-B; CST6; PME; CPI-B; liver thiol proteinase inhibitor; ULD; EPM1; STFB; EPM1A; |
Gene ID | 1476 |
mRNA Refseq | NM_000100 |
Protein Refseq | NP_000091 |
MIM | 601145 |
UniProt ID | P04080 |
◆ Recombinant Proteins | ||
Cstb-4002M | Active Recombinant Mouse Cystatin B, His-tagged | +Inquiry |
CSTB-2037M | Recombinant Mouse CSTB Protein, His (Fc)-Avi-tagged | +Inquiry |
CSTB-1070R | Recombinant Rhesus monkey CSTB Protein, His-tagged | +Inquiry |
CSTB-4003M | Recombinant Mouse CSTB Protein | +Inquiry |
Cstb-1660M | Recombinant Mouse Cstb protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSTB-7224HCL | Recombinant Human CSTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTB Products
Required fields are marked with *
My Review for All CSTB Products
Required fields are marked with *