Recombinant Human CSTF1 protein, His-tagged
| Cat.No. : | CSTF1-3568H | 
| Product Overview : | Recombinant Human CSTF1 protein(1-177 aa), fused to His tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-177 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | CSTF1 cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa [ Homo sapiens ] | 
| Official Symbol | CSTF1 | 
| Synonyms | CSTF1; cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa; cleavage stimulation factor, 3 pre RNA, subunit 1, 50kD; cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; CSTF 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; CstF-50; CstFp50; | 
| Gene ID | 1477 | 
| mRNA Refseq | NM_001033521 | 
| Protein Refseq | NP_001028693 | 
| MIM | 600369 | 
| UniProt ID | Q05048 | 
| ◆ Recombinant Proteins | ||
| CSTF1-11946Z | Recombinant Zebrafish CSTF1 | +Inquiry | 
| Cstf1-2348M | Recombinant Mouse Cstf1 Protein, Myc/DDK-tagged | +Inquiry | 
| CSTF1-2247HF | Recombinant Full Length Human CSTF1 Protein, GST-tagged | +Inquiry | 
| CSTF1-3568H | Recombinant Human CSTF1 protein, His-tagged | +Inquiry | 
| CSTF1-4172H | Recombinant Human CSTF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CSTF1-7223HCL | Recombinant Human CSTF1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTF1 Products
Required fields are marked with *
My Review for All CSTF1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            