Recombinant Human CSTF1 protein, His-tagged
Cat.No. : | CSTF1-3568H |
Product Overview : | Recombinant Human CSTF1 protein(1-177 aa), fused to His tag, was expressed in E. coli. |
Availability | June 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-177 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CSTF1 cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa [ Homo sapiens ] |
Official Symbol | CSTF1 |
Synonyms | CSTF1; cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa; cleavage stimulation factor, 3 pre RNA, subunit 1, 50kD; cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; CSTF 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; CstF-50; CstFp50; |
Gene ID | 1477 |
mRNA Refseq | NM_001033521 |
Protein Refseq | NP_001028693 |
MIM | 600369 |
UniProt ID | Q05048 |
◆ Recombinant Proteins | ||
CSTF1-3045H | Recombinant Human CSTF1, T7-tagged | +Inquiry |
Cstf1-2348M | Recombinant Mouse Cstf1 Protein, Myc/DDK-tagged | +Inquiry |
CSTF1-11946Z | Recombinant Zebrafish CSTF1 | +Inquiry |
CSTF1-3568H | Recombinant Human CSTF1 protein, His-tagged | +Inquiry |
CSTF1-1306R | Recombinant Rat CSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSTF1-7223HCL | Recombinant Human CSTF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTF1 Products
Required fields are marked with *
My Review for All CSTF1 Products
Required fields are marked with *
0
Inquiry Basket