Recombinant Human CSTF1 protein, His-tagged

Cat.No. : CSTF1-3568H
Product Overview : Recombinant Human CSTF1 protein(1-177 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability July 08, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-177 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CSTF1 cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa [ Homo sapiens ]
Official Symbol CSTF1
Synonyms CSTF1; cleavage stimulation factor, 3 pre-RNA, subunit 1, 50kDa; cleavage stimulation factor, 3 pre RNA, subunit 1, 50kD; cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; CSTF 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; CstF-50; CstFp50;
Gene ID 1477
mRNA Refseq NM_001033521
Protein Refseq NP_001028693
MIM 600369
UniProt ID Q05048

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSTF1 Products

Required fields are marked with *

My Review for All CSTF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon