Recombinant Human CT55 Protein, GST-tagged
| Cat.No. : | CT55-2197H |
| Product Overview : | Human CXorf48 full-length ORF ( NP_001026875.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CT55 (Cancer/Testis Antigen 55) is a Protein Coding gene. |
| Molecular Mass : | 55.5 kDa |
| AA Sequence : | MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CT55 cancer/testis antigen 55 [ Homo sapiens (human) ] |
| Official Symbol | CT55 |
| Synonyms | CXORF48; chromosome X open reading frame 48; uncharacterized protein CXorf48; cancer/testis antigen 55; CT55; FLJ20527; tumor antigen BJ-HCC-20; BRCA2-interacting protein; BJHCC20A; RP13-565O16.1; |
| Gene ID | 54967 |
| mRNA Refseq | NM_001031705 |
| Protein Refseq | NP_001026875 |
| UniProt ID | Q8WUE5 |
| ◆ Recombinant Proteins | ||
| CT55-2351HF | Recombinant Full Length Human CT55 Protein, GST-tagged | +Inquiry |
| CT55-2197H | Recombinant Human CT55 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CT55 Products
Required fields are marked with *
My Review for All CT55 Products
Required fields are marked with *
