Recombinant Human CT83 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | CT83-3422H |
Product Overview : | Biotinylated Recombinant Human CT83 protein(Q5H943)(22-113aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 22-113aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Conjugation : | Biotin |
◆ Recombinant Proteins | ||
CT83-2160H | Recombinant Human CT83 Protein, His-tagged | +Inquiry |
CT83-542H | Recombinant Human CT83 Protein, His-B2M-tagged | +Inquiry |
CT83-3422H | Recombinant Human CT83 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
CT83-2451H | Recombinant Human CT83 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CT83-3575HFL | Recombinant Full Length Human CT83 protein, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CT83 Products
Required fields are marked with *
My Review for All CT83 Products
Required fields are marked with *