Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CTAG1A-4933H
Product Overview : CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome.
Molecular Mass : 18 kDa
AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
Official Symbol CTAG1A
Synonyms CTAG1A; cancer/testis antigen 1A; ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2
Gene ID 246100
mRNA Refseq NM_139250
Protein Refseq NP_640343
MIM 300657
UniProt ID P78358

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG1A Products

Required fields are marked with *

My Review for All CTAG1A Products

Required fields are marked with *

0
cart-icon