Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CTAG1A-4933H |
Product Overview : | CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. |
Molecular Mass : | 18 kDa |
AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
Official Symbol | CTAG1A |
Synonyms | CTAG1A; cancer/testis antigen 1A; ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2 |
Gene ID | 246100 |
mRNA Refseq | NM_139250 |
Protein Refseq | NP_640343 |
MIM | 300657 |
UniProt ID | P78358 |
◆ Recombinant Proteins | ||
CTAG1A-152HFL | Recombinant Full Length Human CTAG1A Protein, C-Flag-tagged | +Inquiry |
CTAG1A-2048H | Recombinant Human CTAG1A Protein, GST-tagged | +Inquiry |
CTAG1A-1371H | Recombinant Human CTAG1A Protein (1-180 aa), His-tagged | +Inquiry |
CTAG1A-2257HF | Recombinant Full Length Human CTAG1A Protein, GST-tagged | +Inquiry |
CTAG1A-2072H | Recombinant Human CTAG1A Protein (Met1-Arg180), N-SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *