Recombinant Full Length Human CTAG1A Protein, C-Flag-tagged
| Cat.No. : | CTAG1A-152HFL |
| Product Overview : | Recombinant Full Length Human CTAG1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 17.8 kDa |
| AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
| Official Symbol | CTAG1A |
| Synonyms | ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1 |
| Gene ID | 246100 |
| mRNA Refseq | NM_139250.2 |
| Protein Refseq | NP_640343.1 |
| MIM | 300657 |
| UniProt ID | P78358 |
| ◆ Recombinant Proteins | ||
| CTAG1A-4933H | Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CTAG1A-5004H | Recombinant Human CTAG1A protein, hFc-Myc-tagged | +Inquiry |
| CTAG1A-3362H | Recombinant Human CTAG1A Protein, MYC/DDK-tagged | +Inquiry |
| CTAG1A-677H | Recombinant Human CTAG1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTAG1A-2257HF | Recombinant Full Length Human CTAG1A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *



