Recombinant Human CTAG1B protein, GST-tagged
Cat.No. : | CTAG1B-15H |
Product Overview : | Recombinant Human CTAG1B(67-128aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 67-128 a.a. |
Description : | The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
AA Sequence : | GAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | CTAG1B cancer/testis antigen 1B [ Homo sapiens ] |
Official Symbol | CTAG1B |
Synonyms | CTAG1B; cancer/testis antigen 1B; cancer/testis antigen 1 , CTAG, CTAG1; cancer/testis antigen 1; CT6.1; ESO1; LAGE2A; LAGE2B; NY ESO 1; cancer antigen 3; cancer/testis antigen 6.1; l antigen family member 2; New York esophageal squamous cell carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; CTAG; CTAG1; CTAG1A; LAGE-2; NY-ESO-1; |
Gene ID | 1485 |
mRNA Refseq | NM_001327 |
Protein Refseq | NP_001318 |
MIM | 300156 |
UniProt ID | P78358 |
Chromosome Location | Xq28 |
◆ Recombinant Proteins | ||
CTAG1B-4480H | Recombinant Human Cancer/testis Antigen 1B, GST-tagged | +Inquiry |
CTAG1B-11655H | Recombinant Human CTAG1B, GST-tagged | +Inquiry |
CTAG1B-4403HFL | Recombinant Full Length Human CTAG1B protein, Flag-tagged | +Inquiry |
CTAG1B-01H | Recombinant Human CTAG1B Protein, DYKDDDDK-tagged | +Inquiry |
CTAG1B-16H | Recombinant Human CTAG1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG1B-7218HCL | Recombinant Human CTAG1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG1B Products
Required fields are marked with *
My Review for All CTAG1B Products
Required fields are marked with *
0
Inquiry Basket