Recombinant Human CTAG1B protein, GST-tagged

Cat.No. : CTAG1B-15H
Product Overview : Recombinant Human CTAG1B(67-128aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 67-128 a.a.
Description : The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : GAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name CTAG1B cancer/testis antigen 1B [ Homo sapiens ]
Official Symbol CTAG1B
Synonyms CTAG1B; cancer/testis antigen 1B; cancer/testis antigen 1 , CTAG, CTAG1; cancer/testis antigen 1; CT6.1; ESO1; LAGE2A; LAGE2B; NY ESO 1; cancer antigen 3; cancer/testis antigen 6.1; l antigen family member 2; New York esophageal squamous cell carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; CTAG; CTAG1; CTAG1A; LAGE-2; NY-ESO-1;
Gene ID 1485
mRNA Refseq NM_001327
Protein Refseq NP_001318
MIM 300156
UniProt ID P78358
Chromosome Location Xq28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG1B Products

Required fields are marked with *

My Review for All CTAG1B Products

Required fields are marked with *

0
cart-icon
0
compare icon