Recombinant Human CTAG1B protein, GST-tagged

• Cat.No.: CTAG1B-15H
• Product Overview: Recombinant Human CTAG1B(67-128aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 67-128 a.a.
• Description: The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• AA Sequence: GAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: CTAG1B cancer/testis antigen 1B [ Homo sapiens ]
• Official Symbol: CTAG1B
• Synonyms: CTAG1B; cancer/testis antigen 1B; cancer/testis antigen 1 , CTAG, CTAG1; cancer/testis antigen 1; CT6.1; ESO1; LAGE2A; LAGE2B; NY ESO 1; cancer antigen 3; cancer/testis antigen 6.1; l antigen family member 2; New York esophageal squamous cell carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; CTAG; CTAG1; CTAG1A; LAGE-2; NY-ESO-1
• Gene ID: 1485
• mRNA Refseq: NM_001327
• Protein Refseq: NP_001318
• MIM: 300156
• UniProt ID: P78358
• Chromosome Location: Xq28